| Background |
C-X-C motif chemokine 6 (CXCL6) also named granulocyte chemotactic protein 2 (GCP-2), which is a chemokine of the intercrine alpha family. CXCL6 is a 8.3kDa protein containing 75 amino acid residues. CXCL6 has a significant role in resistance of gram-positive and gram-negative bacteria which is a chemotaxis for neutrophil granulocytes. CXCL6 has a role in in the process of carcinogenesis which affects proliferation and metastasis of OS cells by the interaction with CXCR1 /CXCR2. |
| Synonyms |
C-X-C motif chemokine 6, Granulocyte Chemotactic Protein-2,GCP-2 |
| Uniprot ID |
P80162 |
| Molecular Weight |
The protein has a calculated MW of 8.97 kDa.
The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.
The ED₅₀ for this effect is <10 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
