| Background |
C-X-C motif chemokine 5 (CXCL5) also named epithelial-derived neutrophil-activating peptide 78 (ENA-78), which is a chemokine of the intercrine alpha family. CXCL5 is a 8kDa protein containing 70 amino acid residues. CXCL5 is stimulated by the IL-1 or TNFα during inflammation which produced by the eosinophils and CXCL5 is inhibited by the IFNγ. CXCL5 promotes the formation of blood vessels and angiogenesis by binding the cell receptor CXCR2. |
| Synonyms |
C-X-C motif chemokine 5, Epithelial Neutrophil Activating Peptide-78, ENA-78 |
| Uniprot ID |
P42830 |
| Molecular Weight |
The protein has a calculated MW of 8.51 kDa.
The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.
The ED₅₀ for this effect is <10 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
