Recombinant CXCL4,Human,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM162-5HP 5 ug $75.00
CM162-20HP 20 ug $188.00
CM162-100HP 100 ug $563.00
CM162-500HP 500 ug $1625.00
CM162-1000HP 1 mg $2500.00
Inquire
Product Specifications
Background C-X-C motif chemokine 4 (CXCL4) also named platelet factor 4 (PF4), which is a chemokine of the intercrine alpha family. CXCL4 is a 8kDa protein containing 70 amino acid residues. CXCL4 is produced by the activated platelets which plays an important role in immune responses. CXCL4 inhibit the cell proliferation, platelet aggregation and wound repair. CXCL4 also suppresses the hematopoiesis.
Synonyms C-X-C motif chemokine 4, Platelet Factor-4,PF-4, Oncostatin A, Ironplact
Uniprot ID P02776
Molecular Weight The protein has a calculated MW of 8.58 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE.
Activity Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED₅₀ for this effect is <5 μg/mL.
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus.
Protein Tag His Tag (N-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of recombinant human CXCL4 Human CXCL4, His Tag, E. coli inhibited human FGF-2-induced HUVEC cell proliferation, with the ED₅₀ at 4.87 μg/mL.
Citations
No references are available
Related Products