| Background |
C-X-C motif chemokine 4 (CXCL4) also named platelet factor 4 (PF4), which is a chemokine of the intercrine alpha family. CXCL4 is a 8kDa protein containing 70 amino acid residues. CXCL4 is produced by the activated platelets which plays an important role in immune responses. CXCL4 inhibit the cell proliferation, platelet aggregation and wound repair. CXCL4 also suppresses the hematopoiesis. |
| Synonyms |
C-X-C motif chemokine 4, Platelet Factor-4,PF-4, Oncostatin A, Ironplact |
| Uniprot ID |
P02776 |
| Molecular Weight |
The protein has a calculated MW of 8.58 kDa.
The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells.
The ED₅₀ for this effect is <5 μg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |