cytokine

Recombinant CXCL4，Human，Animal-Free

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM162-5HP		5 ug	$75.00
CM162-20HP		20 ug	$188.00
CM162-100HP		100 ug	$563.00
CM162-500HP		500 ug	$1625.00
CM162-1000HP		1 mg	$2500.00

Inquire

Product Specifications

Background	C-X-C motif chemokine 4 (CXCL4) also named platelet factor 4 (PF4), which is a chemokine of the intercrine alpha family. CXCL4 is a 8kDa protein containing 70 amino acid residues. CXCL4 is produced by the activated platelets which plays an important role in immune responses. CXCL4 inhibit the cell proliferation, platelet aggregation and wound repair. CXCL4 also suppresses the hematopoiesis.
Synonyms	C-X-C motif chemokine 4, Platelet Factor-4,PF-4, Oncostatin A, Ironplact
Uniprot ID	P02776
Molecular Weight	The protein has a calculated MW of 8.58 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>98% as determined by SDS-PAGE.
Activity	Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED₅₀ for this effect is <5 μg/mL.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence	EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus.
Protein Tag	His Tag (N-term)
Form	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of recombinant human CXCL4	Human CXCL4, His Tag, E. coli inhibited human FGF-2-induced HUVEC cell proliferation, with the ED₅₀ at 4.87 μg/mL.

Citations

No references are available