| Background |
C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GROβ), which is a chemokine of the intercrine alpha family. CXCL2 is a 8 kDa protein containing 73 amino acid residues. CXCL2 is expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affect the cell proliferation, differentiation and migration. |
| Synonyms |
C-X-C motif chemokine 2, Growth Regulated Protein/Melanoma Growth Stimulatory Activity,GRO-β: MGSAβ,MIP-2α, GRO2 |
| Uniprot ID |
P19875 |
| Molecular Weight |
The protein has a calculated MW of 8.70 kDa.
The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
