| Background |
Cerebral dopamine neurotrophic factor (CDNF) also known as ARMETL1, which is a member of ARMET family. CDNF is a 20.9 kDa neurotrophic factor containing 187 residues that widely expressed in various tissues, including embryonic and postnatal brain. Besides, CDNF shows the ability to protect the degeneration of dopaminergic neurons in Parkinson’s disease, induced by 6-hydroxydopamine (6-OHDA). Moreover, as a neurotrophic factor, CDNF also can repair the dopaminergic function of dopaminergic neurons. |
| Synonyms |
cerebral dopamine neurotrophic factor, ARMETL1 |
| Uniprot ID |
Q49AH0 |
| Molecular Weight |
The protein has a calculated MW of 19.26 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Testing in process |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
