| Background |
Human CD27L is also named for CD70 which is one member of TNF family. Human CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. Human CD27L is a 23 kDa cytokine with 154 amino acid residues which is a transmembrane glycoprotein. Human CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy. |
| Synonyms |
CD27 ligand, soluble CD27 Ligand, sCD27 Ligand, TNFSF7, CD70 |
| Uniprot ID |
P32970 |
| Molecular Weight |
The protein has a calculated MW of 18.08 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce IL-8 secretion in human PBMCs.
The ED₅₀ for this effect is <0.6 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP with polyhistidine tag at the N-terminus |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing containing 0.05% sarkosyl, in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
