cytokine

Recombinant BMP-8b，Human，Animal-Free

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM070-5HP		5 ug	$75.00
CM070-20HP		20 ug	$188.00
CM070-100HP		100 ug	$563.00
CM070-500HP		500 ug	$1625.00
CM070-1000HP		1 mg	$2500.00

Inquire

Product Specifications

Background	Bone Morphogenetic Protein-8B (BMP-8B) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-8B can bind with the TGF-β receptor and is involved in SMAD protein signal transduction. BMP-8B plays a role in bone and cartilage development. It is expressed in brown adipose tissues and the hypothalamus, which can affect thermogenesis and susceptibility to obesity.
Synonyms	bone morphogenetic protein 8b, OP-2 (Osteogenic Protein-2), BMP8
Uniprot ID	P34820
Molecular Weight	The protein has a calculated MW of 16.48 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>98% as determined by SDS-PAGE.
Activity	Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <21.8 ng/mL.
Endotoxin Level	<0.01 EU per 1 μg of the protein by the LAL method.
Protein Sequence	AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the N-terminus.
Protein Tag	His Tag (N-term)
Form	The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of recombinant human BMP-8b	Human BMP-8b, His Tag, E. coli induced alkaline phosphatase production by ATDC5 cells, with the ED₅₀ at 21.73 ng/mL.

Citations

No references are available