| Background |
Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-8 can bind with TGF-β receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development. |
| Synonyms |
bone morphogenetic protein 8a, BMP-8,OP-2,Osteogenic Protein-2, BMP8 |
| Uniprot ID |
Q7Z5Y6 |
| Molecular Weight |
The protein has a calculated MW of 16.61 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is 10-19.4 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
