| Background |
Bone Morphogenetic Protein-5 (BMP-5) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-5 can bind with TGF-β receptors and trigger SMAD protein signal transduction. It is involved in many negatively regulated physiological processes, such as the aldosterone biosynthetic process and epithelial to mesenchymal transition. BMP-5 also plays a vital role in cartilage synthesis. |
| Synonyms |
bone morphogenetic protein 5, BMP5 |
| Uniprot ID |
P22003 |
| Molecular Weight |
The protein has a calculated MW of 16.57 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is <0.17 μg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
