| Background |
Bone Morphogenetic Protein-3 (BMP-3) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-3 can bind with TGF-β receptor and participate in SMAD protein signal transduction through triggering pathway-restricted SMAD protein phosphorylation. The primary function of BMP-3 is osteoblast differentiation and Induces bone formation. |
| Synonyms |
bone morphogenetic protein 3, Osteogenin, BMP-3A, BMP3 |
| Uniprot ID |
P12645 |
| Molecular Weight |
The protein has a calculated MW of 13.34 kDa.
The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is < 10 μg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
