cytokine

Recombinant BMP-15，Human，Animal-Free

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM077-5HP		5 ug	$75.00
CM077-20HP		20 ug	$188.00
CM077-100HP		100 ug	$563.00
CM077-500HP		500 ug	$1625.00
CM077-1000HP		1 mg	$2500.00

Inquire

Product Specifications

Background	Bone Morphogenetic Protein-15 (BMP-15) is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. In the ovarian follicles, BMP-15 has a vital role in regulating the growth and maturation of follicles, the sensitivity of granulosa cells to FSH, and preventing granulosa cells from apoptosis. In addition, BMP-15 and GDF9 cooperate and have the same interaction on target cells.
Synonyms	bone morphogenetic protein 15, Growth/Differentiation Factor-9B, GDF-9B, ODG2, POF4, BMP15
Uniprot ID	O95972
Molecular Weight	The protein has a calculated MW of 14.88 kDa. The protein migrates as 13-18 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>98% as determined by SDS-PAGE.
Activity	Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <17 ng/mL.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence	MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidinetag at the C- terminus
Protein Tag	His Tag (C-term)
Form	The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Application	Cell Culture

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Scientific Data


SDS- PAGE analysis of recombinant human BMP-15	Human BMP-15, His Tag, E. coli induced alkaline phosphatase production by ATDC5 cells, with the ED₅₀ at 16.6 ng/mL.

Citations

No references are available