| Background |
Bone Morphogenetic Protein-14 (BMP-14), known as Growth differentiation factor 5 (GDF5), is an extracellular multifunctional cytokine that is also a member of the TGFβ family. BMP-14 can bind with the TGFβ receptor and trigger SMAD protein signal transduction. BMP-14 plays a role in skeletal and joint development and increases the survival of neurons that respond to the neurotransmitter dopamine. |
| Synonyms |
bone morphogenetic protein 14, Cartilage-Derived Morphogenetic Protein-1,Growth/Differentiation Factor-5,GDF-5, CDMP-1, BMP14 |
| Uniprot ID |
P43026 |
| Molecular Weight |
The protein has a calculated MW of 14.52 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is <14 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
