Background |
Bone Morphogenetic Protein-13 (BMP-13), known as Growth differentiation factor 6 (GDF6), is an extracellular multifunctional cytokine that is also a member of the TGFβ family. BMP-13 can bind with the TGFβ receptor and induce SMAD protein signal transduction. BMP-13 is a regulatory protein that can affect the growth and differentiation of developing embryos. Moreover, it plays a role in regulating the patterning of the ectoderm and controlling eye development. |
Synonyms |
bone morphogenetic protein 13, subunit (CLMF p35), NK cell Stimulating Factor Chain 1, BMP13 |
Uniprot ID |
Q6KF10 |
Molecular Weight |
The protein has a calculated MW of 14.50 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>98% as determined by SDS-PAGE. |
Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is 63-240 ng/mL. |
Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
MTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus. |
Protein Tag |
His Tag (C-term) |
Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
Application |
Cell Culture |