| Background |
Bone Morphogenetic Protein-11 (BMP-11), known as Growth differentiation factor 11 (GDF11), is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. BMP-11 can bind with the TGFβ receptor and is involved in SMAD protein signal transduction. Moreover, it promotes the formation of blood vessels and nerves that can control anterior-posterior patterning. |
| Synonyms |
bone morphogenetic protein 11, Growth/Differentiation Factor-11, GDF-11, BMP11 |
| Uniprot ID |
O95390 |
| Molecular Weight |
The protein has a calculated MW of 13.40 kDa.
The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is <11 ng/mL.
Measure by its ability to induce hemoglobin expression in K562 cells.
The ED₅₀ for this effect is <4 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
