| Background |
Bone Morphogenetic Protein-10 (BMP-10) is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. BMP-10 can bind with TGFβ receptor and is involved in SMAD protein signal transduction. The functions related to bone generation can induce bone and cartilage formation. Different from other family members, BMP-10 is a novel protein involved in the heart's trabeculation. |
| Synonyms |
bone morphogenetic protein 10, BMP10 |
| Uniprot ID |
O95393 |
| Molecular Weight |
The protein has a calculated MW of 13.10 kDa.
The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.
The ED₅₀ for this effect is 1.7-2.1 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
