| Background |
Nerve Growth Factors (NGF) is critical for the development and maintenance of the sympathetic and sensory neuron systems. NGF has been demonstrated as a complex that consists of three polypeptides named α, β and γ subunits. Among then, β subunit, which known as beta-NGF is a 26.9 kDa protein containing 241 residues that involve in neuronal survival and differentiation. Besides, beta-NGF also acts as a ligand to TRKA receptor, which indispensable for the differentiation and development of pain and temperature sensing neurons. |
| Synonyms |
nerve growth factor-beta, β-Nerve Growth Factor, NGF-β |
| Uniprot ID |
P01138 |
| Molecular Weight |
The protein has a calculated MW of 14.43 kDa.
The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce TF-1 cells proliferation.
The ED₅₀ for this effect is <0.7 ng/mL.
The specific activity of recombinant human beta-NGF is > 1 x 10⁶ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
