| Background |
APRIL is a member of tumor necrosis factor ligand superfamily that expressed by stromal tissue, macrophages, and T cells. APRIL is a 27.4 kDa protein containing 250 residues, which plays a critical role in modulating tumor progression. Besides, APRIL has been demonstrated to involve in regulating B and T cell survival, proliferation and differentiation via binding with TNFRSF13B/TACI and TNFRSF17/BCMA. |
| Synonyms |
A proliferation-inducing ligand, TNFSF13, CD256, TALL-2, TALL2, TNLG7B, TRDL-1, UNQ383/PRO715, ZTNF2 |
| Uniprot ID |
AAQ91388 |
| Molecular Weight |
The protein has a calculated MW of 17.29 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measured by its ability to induce cell death in Jurkat cells.
The ED₅₀ for this effect is 2.6-4.0 μg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
