Recombinant APRIL,Human,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM048-5HP 5 ug $75.00
CM048-20HP 20 ug $188.00
CM048-100HP 100 ug $563.00
CM048-500HP 500 ug $1625.00
CM048-1000HP 1 mg $2500.00
Inquire
Product Specifications
Background APRIL is a member of tumor necrosis factor ligand superfamily that expressed by stromal tissue, macrophages, and T cells. APRIL is a 27.4 kDa protein containing 250 residues, which plays a critical role in modulating tumor progression. Besides, APRIL has been demonstrated to involve in regulating B and T cell survival, proliferation and differentiation via binding with TNFRSF13B/TACI and TNFRSF17/BCMA.
Synonyms A proliferation-inducing ligand, TNFSF13, CD256, TALL-2, TALL2, TNLG7B, TRDL-1, UNQ383/PRO715, ZTNF2
Uniprot ID AAQ91388
Molecular Weight The protein has a calculated MW of 17.29 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE.
Activity Measured by its ability to induce cell death in Jurkat cells. The ED₅₀ for this effect is 2.6-4.0 μg/mL.
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of recombinant human APRIL
Citations
No references are available
Related Products