| Background | 
                                Annexin V predicts a molecular mass of 36.8 kDa. is commonly used to detect apoptotic cells by its ability to bind to phosphatidylserine, a marker of apoptosis when it is on the outer leaflet of the plasma membrane. Annexin V forms a shield around negatively charged phospholipid molecules. The formation of an annexin V shield blocks the entry of phospholipids into coagulation reactions. | 
                            
                            
                            
                                | Synonyms | 
                                ANXA5, ANX5, ENX2, HEL-S-7, PP4, RPRGL3 | 
                            
                            
                            
                                | Uniprot ID | 
                                P08758 | 
                            
                            
                            
                                | Molecular Weight | 
                                The protein has a calculated MW of 36.75 kDa.
The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis). | 
                            
                            
                            
                                | Expression System | 
                                Escherichia coli | 
                            
                            
                            
                                | Purity | 
                                >98% as determined by SDS-PAGE. | 
                            
                            
                            
                                | Activity | 
                                Testing in process | 
                            
                            
                            
                                | Endotoxin Level | 
                                <0.1 EU per 1 μg of the protein by the LAL method. | 
                            
                            
                            
                                | Protein Sequence | 
                                MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD with polyhistidine tag at the C-terminus. | 
                            
                            
                            
                                | Protein Tag | 
                                His Tag (C-term) | 
                            
                            
                            
                                | Form | 
                                The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. | 
                            
                            
                           
                              
                                | Application | 
                                Cell Culture |