| Background |
AITRL also known as TNFSF18, GITRL and TL6, belonging to TNF superfamily. AITRL is a 20.3 kDa protein containing 177 residues that implicates in regulating immune systems. AITRL contributes to tumor suppression and the development of autoimmune diseases via interacting with TNFRSF18/AITR/GITR. Besides, AITRL-GITR signaling has been demonstrated to enhance phosphorylation of STAT1 and up-regulate expression of VCAM1 and ICAM1 in endothelial cells. Furthermore, AITRL can also facilitate the adhesion and transmigration of leukocytes to endothelial cells. |
| Synonyms |
activation-induced TNFR member ligand, TL6, GITRL, TNLG2A, hGITRL, TNFSF18 |
| Uniprot ID |
Q9UNG2 |
| Molecular Weight |
The protein has a calculated MW of 15.34 kDa.
The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce IL-8 secretion in human PBMC using a concentration range of 5-200 ng /mL. Note: Result may vary from different PBMC donors. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGII LIANPQEI with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
