| Background | 
                                Activin B is the cytokine of the TGF-beta family, which is a 13 kDa protein containing 115 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. They also have a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element. | 
                            
                            
                            
                                | Synonyms | 
                                Activin Beta B, INHBB; inhibin beta B chain | 
                            
                            
                            
                                | Uniprot ID | 
                                P09529 | 
                            
                            
                            
                                | Molecular Weight | 
                                The protein has a calculated MW of 13.75 kDa.The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis). | 
                            
                            
                            
                                | Expression System | 
                                Escherichia coli | 
                            
                            
                            
                                | Purity | 
                                >98% as determined by SDS-PAGE. | 
                            
                            
                            
                                | Activity | 
                                Measure by its ability to induce hemoglobin expression in K562 cells.
The ED₅₀ for this effect is <0.7 ng/mL.
The specific activity of recombinant human Activin B is > 1.5 x 10⁶ IU/mg. | 
                            
                            
                            
                                | Endotoxin Level | 
                                <0.1 EU per 1 μg of the protein by the LAL method. | 
                            
                            
                            
                                | Protein Sequence | 
                                MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus. | 
                            
                            
                            
                                | Protein Tag | 
                                His Tag (C-term) | 
                            
                            
                            
                                | Form | 
                                The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. | 
                            
                            
                           
                              
                                | Application | 
                                Cell Culture |