| Background |
Activin B is the cytokine of the TGF-beta family, which is a 13 kDa protein containing 115 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. They also have a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element. |
| Synonyms |
Activin Beta B, INHBB; inhibin beta B chain |
| Uniprot ID |
P09529 |
| Molecular Weight |
The protein has a calculated MW of 13.75 kDa.
The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce hemoglobin expression in K562 cells.
The ED₅₀ for this effect is <0.7 ng/mL.
The specific activity of recombinant human Activin B is > 1.5 x 10⁶ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |