cytokine

Recombinant Activin B，Human，Animal-Free

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM119-5HP		5 ug	$75.00
CM119-20HP		20 ug	$188.00
CM119-100HP		100 ug	$563.00
CM119-500HP		500 ug	$1625.00
CM119-1000HP		1 mg	$2500.00

Inquire

Product Specifications

Background	Activin B is the cytokine of the TGF-beta family, which is a 13 kDa protein containing 115 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. They also have a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element.
Synonyms	Activin Beta B, INHBB; inhibin beta B chain
Uniprot ID	P09529
Molecular Weight	The protein has a calculated MW of 13.75 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>98% as determined by SDS-PAGE.
Activity	Measure by its ability to induce hemoglobin expression in K562 cells. The ED₅₀ for this effect is <0.7 ng/mL. The specific activity of recombinant human Activin B is > 1.5 x 10⁶ IU/mg.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence	MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.
Protein Tag	His Tag (C-term)
Form	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of recombinant human Activin B	Human Activin B, His Tag, E. coli induced hemoglobin expression in K562 cells, with the ED₅₀ at 0.651 ng/mL.

Citations

No references are available